Anti PRKAR2B pAb (ATL-HPA008421 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008421-25

Protein Description: protein kinase, cAMP-dependent, regulatory, type II, beta
Gene Name: PRKAR2B
Alternative Gene Name: PRKAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002997: 93%, ENSRNOG00000009079: 94%
Entrez Gene ID: 5577
Uniprot ID: P31323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH
• Gene Sequence: GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH
• Gene ID - Mouse: ENSMUSG00000002997
• Gene ID - Rat: ENSRNOG00000009079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PRKAR2B pAb (ATL-HPA008421 w/enhanced validation) – 2 Found

Weigand, Isabel; Ronchi, Cristina L; Rizk-Rabin, Marthe; Dalmazi, Guido Di; Wild, Vanessa; Bathon, Kerstin; Rubin, Beatrice; Calebiro, Davide; Beuschlein, Felix; Bertherat, Jérôme; Fassnacht, Martin; Sbiera, Silviu. Differential expression of the protein kinase A subunits in normal adrenal glands and adrenocortical adenomas. Scientific Reports. 2017;7(1):49. 

Godbole, Amod; Lyga, Sandra; Lohse, Martin J; Calebiro, Davide. Internalized TSH receptors en route to the TGN induce local G(s)-protein signaling and gene transcription. Nature Communications. 2017;8(1):443.