Anti PLA2G6 pAb (ATL-HPA001171 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001171-25

Protein Description: phospholipase A2, group VI (cytosolic, calcium-independent)
Gene Name: PLA2G6
Alternative Gene Name: iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042632: 91%, ENSRNOG00000012295: 91%
Entrez Gene ID: 8398
Uniprot ID: O60733
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
• Gene Sequence: QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
• Gene ID - Mouse: ENSMUSG00000042632
• Gene ID - Rat: ENSRNOG00000012295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLA2G6 pAb (ATL-HPA001171 w/enhanced validation) – 2 Found

Paliege, A; Roeschel, T; Neymeyer, H; Seidel, S; Kahl, T; Daigeler, A L; Mutig, K; Mrowka, R; Ferreri, N R; Wilson, B S; Himmerkus, N; Bleich, M; Bachmann, S. Group VIA phospholipase A2 is a target for vasopressin signaling in the thick ascending limb. American Journal Of Physiology. Renal Physiology. 2012;302(7):F865-74. 

Lin, Guang; Tepe, Burak; McGrane, Geoff; Tipon, Regine C; Croft, Gist; Panwala, Leena; Hope, Amanda; Liang, Agnes J H; Zuo, Zhongyuan; Byeon, Seul Kee; Wang, Lily; Pandey, Akhilesh; Bellen, Hugo J. Exploring therapeutic strategies for infantile neuronal axonal dystrophy (INAD/PARK14). Elife. 2023;12( 36645408)