Anti PKIB pAb (ATL-HPA030156)

Atlas Antibodies

Catalog No.: ATL-HPA030156-25

Protein Description: protein kinase (cAMP-dependent, catalytic) inhibitor beta
Gene Name: PKIB
Alternative Gene Name: PRKACN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019876: 75%, ENSRNOG00000000811: 72%
Entrez Gene ID: 5570
Uniprot ID: Q9C010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDA
• Gene Sequence: MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDA
• Gene ID - Mouse: ENSMUSG00000019876
• Gene ID - Rat: ENSRNOG00000000811
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.