Anti PKIB pAb (ATL-HPA030156)

Atlas Antibodies

Catalog No.:
ATL-HPA030156-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein kinase (cAMP-dependent, catalytic) inhibitor beta
Gene Name: PKIB
Alternative Gene Name: PRKACN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019876: 75%, ENSRNOG00000000811: 72%
Entrez Gene ID: 5570
Uniprot ID: Q9C010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDA
Gene Sequence MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDA
Gene ID - Mouse ENSMUSG00000019876
Gene ID - Rat ENSRNOG00000000811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PKIB pAb (ATL-HPA030156)
Datasheet Anti PKIB pAb (ATL-HPA030156) Datasheet (External Link)
Vendor Page Anti PKIB pAb (ATL-HPA030156) at Atlas Antibodies

Documents & Links for Anti PKIB pAb (ATL-HPA030156)
Datasheet Anti PKIB pAb (ATL-HPA030156) Datasheet (External Link)
Vendor Page Anti PKIB pAb (ATL-HPA030156)