Anti PICALM pAb (ATL-HPA019053 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019053-25

Protein Description: phosphatidylinositol binding clathrin assembly protein
Gene Name: PICALM
Alternative Gene Name: CALM, CLTH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039361: 93%, ENSRNOG00000018322: 88%
Entrez Gene ID: 8301
Uniprot ID: Q13492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA
• Gene Sequence: VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA
• Gene ID - Mouse: ENSMUSG00000039361
• Gene ID - Rat: ENSRNOG00000018322
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) – 3 Found

Heath, Jessica L; Weiss, Joshua M; Lavau, Catherine P; Wechsler, Daniel S. Effects of iron depletion on CALM-AF10 leukemias. Experimental Hematology. 2014;42(12):1022-1030.e1. 

Storck, Steffen E; Hartz, Anika M S; Bernard, Jessica; Wolf, Andrea; Kachlmeier, André; Mahringer, Anne; Weggen, Sascha; Pahnke, Jens; Pietrzik, Claus U. The concerted amyloid-beta clearance of LRP1 and ABCB1/P-gp across the blood-brain barrier is linked by PICALM. Brain, Behavior, And Immunity. 2018;73( 30041013):21-33. 

Ando, Kunie; Nagaraj, Siranjeevi; Küçükali, Fahri; de Fisenne, Marie-Ange; Kosa, Andreea-Claudia; Doeraene, Emilie; Lopez Gutierrez, Lidia; Brion, Jean-Pierre; Leroy, Karelle. PICALM and Alzheimer's Disease: An Update and Perspectives. Cells. 2022;11(24)