Anti PELI3 pAb (ATL-HPA062281)

Atlas Antibodies

Catalog No.:
ATL-HPA062281-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pellino E3 ubiquitin protein ligase family member 3
Gene Name: PELI3
Alternative Gene Name: MGC35521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024901: 97%, ENSRNOG00000019950: 97%
Entrez Gene ID: 246330
Uniprot ID: Q8N2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
Gene Sequence RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
Gene ID - Mouse ENSMUSG00000024901
Gene ID - Rat ENSRNOG00000019950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PELI3 pAb (ATL-HPA062281)
Datasheet Anti PELI3 pAb (ATL-HPA062281) Datasheet (External Link)
Vendor Page Anti PELI3 pAb (ATL-HPA062281) at Atlas Antibodies

Documents & Links for Anti PELI3 pAb (ATL-HPA062281)
Datasheet Anti PELI3 pAb (ATL-HPA062281) Datasheet (External Link)
Vendor Page Anti PELI3 pAb (ATL-HPA062281)