Anti PCED1B pAb (ATL-HPA043901)

Atlas Antibodies

Catalog No.:
ATL-HPA043901-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: PC-esterase domain containing 1B
Gene Name: PCED1B
Alternative Gene Name: FAM113B, MGC16044
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037773: 63%, ENSRNOG00000021221: 61%
Entrez Gene ID: 91523
Uniprot ID: Q96HM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD
Gene Sequence LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD
Gene ID - Mouse ENSMUSG00000037773
Gene ID - Rat ENSRNOG00000021221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCED1B pAb (ATL-HPA043901)
Datasheet Anti PCED1B pAb (ATL-HPA043901) Datasheet (External Link)
Vendor Page Anti PCED1B pAb (ATL-HPA043901) at Atlas Antibodies

Documents & Links for Anti PCED1B pAb (ATL-HPA043901)
Datasheet Anti PCED1B pAb (ATL-HPA043901) Datasheet (External Link)
Vendor Page Anti PCED1B pAb (ATL-HPA043901)