Anti ORC3 pAb (ATL-HPA039553)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039553-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ORC3
Alternative Gene Name: IMAGE50150, LATHEO, ORC3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040044: 71%, ENSRNOG00000008314: 76%
Entrez Gene ID: 23595
Uniprot ID: Q9UBD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD |
Gene Sequence | NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD |
Gene ID - Mouse | ENSMUSG00000040044 |
Gene ID - Rat | ENSRNOG00000008314 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ORC3 pAb (ATL-HPA039553) | |
Datasheet | Anti ORC3 pAb (ATL-HPA039553) Datasheet (External Link) |
Vendor Page | Anti ORC3 pAb (ATL-HPA039553) at Atlas Antibodies |
Documents & Links for Anti ORC3 pAb (ATL-HPA039553) | |
Datasheet | Anti ORC3 pAb (ATL-HPA039553) Datasheet (External Link) |
Vendor Page | Anti ORC3 pAb (ATL-HPA039553) |