Anti ORC1 pAb (ATL-HPA027450)

Atlas Antibodies

Catalog No.:
ATL-HPA027450-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: origin recognition complex, subunit 1
Gene Name: ORC1
Alternative Gene Name: HSORC1, ORC1L, PARC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028587: 90%, ENSRNOG00000008841: 93%
Entrez Gene ID: 4998
Uniprot ID: Q13415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDE
Gene Sequence YISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDE
Gene ID - Mouse ENSMUSG00000028587
Gene ID - Rat ENSRNOG00000008841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORC1 pAb (ATL-HPA027450)
Datasheet Anti ORC1 pAb (ATL-HPA027450) Datasheet (External Link)
Vendor Page Anti ORC1 pAb (ATL-HPA027450) at Atlas Antibodies

Documents & Links for Anti ORC1 pAb (ATL-HPA027450)
Datasheet Anti ORC1 pAb (ATL-HPA027450) Datasheet (External Link)
Vendor Page Anti ORC1 pAb (ATL-HPA027450)