Anti NOTUM pAb (ATL-HPA022851)

Atlas Antibodies

Catalog No.:
ATL-HPA022851-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: notum, palmitoleoyl-protein carboxylesterase
Gene Name: NOTUM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042988: 93%, ENSRNOG00000036680: 93%
Entrez Gene ID: 147111
Uniprot ID: Q6P988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFL
Gene Sequence ANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFL
Gene ID - Mouse ENSMUSG00000042988
Gene ID - Rat ENSRNOG00000036680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NOTUM pAb (ATL-HPA022851)
Datasheet Anti NOTUM pAb (ATL-HPA022851) Datasheet (External Link)
Vendor Page Anti NOTUM pAb (ATL-HPA022851) at Atlas Antibodies

Documents & Links for Anti NOTUM pAb (ATL-HPA022851)
Datasheet Anti NOTUM pAb (ATL-HPA022851) Datasheet (External Link)
Vendor Page Anti NOTUM pAb (ATL-HPA022851)