Anti NFIA pAb (ATL-HPA006111 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006111-25

Protein Description: nuclear factor I/A
Gene Name: NFIA
Alternative Gene Name: KIAA1439, NFI-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028565: 98%, ENSRNOG00000006966: 100%
Entrez Gene ID: 4774
Uniprot ID: Q12857
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ
• Gene Sequence: LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ
• Gene ID - Mouse: ENSMUSG00000028565
• Gene ID - Rat: ENSRNOG00000006966
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFIA pAb (ATL-HPA006111 w/enhanced validation) – 11 Found

Doi, Toru; Ogata, Toru; Yamauchi, Junji; Sawada, Yasuhiro; Tanaka, Sakae; Nagao, Motoshi. Chd7 Collaborates with Sox2 to Regulate Activation of Oligodendrocyte Precursor Cells after Spinal Cord Injury. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2017;37(43):10290-10309. 

Keeley, Patrick W; Reese, Benjamin E. DNER and NFIA are expressed by developing and mature AII amacrine cells in the mouse retina. The Journal Of Comparative Neurology. 2018;526(3):467-479. 

Hourigan, Brenna; Balay, Spencer D; Yee, Graydon; Sharma, Saloni; Tan, Qiumin. Capicua regulates the development of adult-born neurons in the hippocampus. Scientific Reports. 2021;11(1):11725. 

Nagao, Motoshi; Ogata, Toru; Sawada, Yasuhiro; Gotoh, Yukiko. Zbtb20 promotes astrocytogenesis during neocortical development. Nature Communications. 2016;7( 27000654):11102. 

Klum, Susanne; Zaouter, Cécile; Alekseenko, Zhanna; Björklund, Åsa K; Hagey, Daniel W; Ericson, Johan; Muhr, Jonas; Bergsland, Maria. Sequentially acting SOX proteins orchestrate astrocyte- and oligodendrocyte-specific gene expression. Embo Reports. 2018;19(11) 

Laug, Dylan; Huang, Teng-Wei; Huerta, Navish A Bosquez; Huang, Anna Yu-Szu; Sardar, Debosmita; Ortiz-Guzman, Joshua; Carlson, Jeffrey C; Arenkiel, Benjamin R; Kuo, Chay T; Mohila, Carrie A; Glasgow, Stacey M; Lee, Hyun Kyoung; Deneen, Benjamin. Nuclear factor I-A regulates diverse reactive astrocyte responses after CNS injury. The Journal Of Clinical Investigation. 2019;129(10):4408-4418. 

Hiraike, Yuta; Waki, Hironori; Miyake, Kana; Wada, Takahito; Oguchi, Misato; Saito, Kaede; Tsutsumi, Shuichi; Aburatani, Hiroyuki; Yamauchi, Toshimasa; Kadowaki, Takashi. NFIA differentially controls adipogenic and myogenic gene program through distinct pathways to ensure brown and beige adipocyte differentiation. Plos Genetics. 2020;16(9):e1009044. 

Kang, Donghee; Shin, Wonjung; Yoo, Hyunjeong; Kim, Seongjae; Lee, Seongju; Rhee, Kunsoo. Cep215 is essential for morphological differentiation of astrocytes. Scientific Reports. 2020;10(1):17000. 

Sardar, Debosmita; Lozzi, Brittney; Woo, Junsung; Huang, Teng-Wei; Cvetkovic, Caroline; Creighton, Chad J; Krencik, Robert; Deneen, Benjamin. Mapping Astrocyte Transcriptional Signatures in Response to Neuroactive Compounds. International Journal Of Molecular Sciences. 2021;22(8) 

Huang, Anna Yu-Szu; Woo, Junsung; Sardar, Debosmita; Lozzi, Brittney; Bosquez Huerta, Navish A; Lin, Chia-Ching John; Felice, Daniela; Jain, Antrix; Paulucci-Holthauzen, Adriana; Deneen, Benjamin. Region-Specific Transcriptional Control of Astrocyte Function Oversees Local Circuit Activities. Neuron. 2020;106(6):992-1008.e9. 

Hiraike, Yuta; Tsutsumi, Shuichi; Wada, Takahito; Oguchi, Misato; Saito, Kaede; Nakamura, Masahiro; Ota, Satoshi; Koebis, Michinori; Nakao, Harumi; Aiba, Atsu; Nagano, Gaku; Ohno, Haruya; Oki, Kenji; Yoneda, Masayasu; Kadowaki, Takashi; Aburatani, Hiroyuki; Waki, Hironori; Yamauchi, Toshimasa. NFIA determines the cis-effect of genetic variation on Ucp1 expression in murine thermogenic adipocytes. Iscience. 2022;25(8):104729.