Anti NEK3 pAb (ATL-HPA019062)

Atlas Antibodies

Catalog No.:
ATL-HPA019062-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NIMA-related kinase 3
Gene Name: NEK3
Alternative Gene Name: HSPK36, MGC29949
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031478: 64%, ENSRNOG00000012757: 60%
Entrez Gene ID: 4752
Uniprot ID: P51956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV
Gene Sequence NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV
Gene ID - Mouse ENSMUSG00000031478
Gene ID - Rat ENSRNOG00000012757
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEK3 pAb (ATL-HPA019062)
Datasheet Anti NEK3 pAb (ATL-HPA019062) Datasheet (External Link)
Vendor Page Anti NEK3 pAb (ATL-HPA019062) at Atlas Antibodies

Documents & Links for Anti NEK3 pAb (ATL-HPA019062)
Datasheet Anti NEK3 pAb (ATL-HPA019062) Datasheet (External Link)
Vendor Page Anti NEK3 pAb (ATL-HPA019062)