Anti NEK3 pAb (ATL-HPA019062)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019062-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NEK3
Alternative Gene Name: HSPK36, MGC29949
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031478: 64%, ENSRNOG00000012757: 60%
Entrez Gene ID: 4752
Uniprot ID: P51956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV |
Gene Sequence | NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV |
Gene ID - Mouse | ENSMUSG00000031478 |
Gene ID - Rat | ENSRNOG00000012757 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NEK3 pAb (ATL-HPA019062) | |
Datasheet | Anti NEK3 pAb (ATL-HPA019062) Datasheet (External Link) |
Vendor Page | Anti NEK3 pAb (ATL-HPA019062) at Atlas Antibodies |
Documents & Links for Anti NEK3 pAb (ATL-HPA019062) | |
Datasheet | Anti NEK3 pAb (ATL-HPA019062) Datasheet (External Link) |
Vendor Page | Anti NEK3 pAb (ATL-HPA019062) |