Anti NCAM1 pAb (ATL-HPA039835 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039835-100

Protein Description: neural cell adhesion molecule 1
Gene Name: NCAM1
Alternative Gene Name: CD56, NCAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039542: 93%, ENSRNOG00000031890: 94%
Entrez Gene ID: 4684
Uniprot ID: P13591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
• Gene Sequence: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
• Gene ID - Mouse: ENSMUSG00000039542
• Gene ID - Rat: ENSRNOG00000031890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCAM1 pAb (ATL-HPA039835 w/enhanced validation) – 3 Found

Yang, Bao; Yang, Chenlong; Fang, Jingyi; Yang, Jun; Xu, Yulun. Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases. Oncology Letters. 2017;14(3):3825-3831. 

Caza, Tiffany N; Hassen, Samar I; Kuperman, Michael; Sharma, Shree G; Dvanajscak, Zeljko; Arthur, John; Edmondson, Rick; Storey, Aaron; Herzog, Christian; Kenan, Daniel J; Larsen, Christopher P. Neural cell adhesion molecule 1 is a novel autoantigen in membranous lupus nephritis. Kidney International. 2021;100(1):171-181. 

Caza, Tiffany N; Hassen, Samar I; Kenan, Daniel J; Storey, Aaron; Arthur, John M; Herzog, Christian; Edmondson, Rick D; Bourne, T David; Beck, Laurence H Jr; Larsen, Christopher P. Transforming Growth Factor Beta Receptor 3 (TGFBR3)-Associated Membranous Nephropathy. Kidney360. 2021;2(8):1275-1286.