Anti MX2 pAb (ATL-HPA030235)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030235-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MX2
Alternative Gene Name: MXB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038777: 28%, ENSRNOG00000013237: 29%
Entrez Gene ID: 4600
Uniprot ID: P20592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG |
Gene Sequence | PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG |
Gene ID - Mouse | ENSMUSG00000038777 |
Gene ID - Rat | ENSRNOG00000013237 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MX2 pAb (ATL-HPA030235) | |
Datasheet | Anti MX2 pAb (ATL-HPA030235) Datasheet (External Link) |
Vendor Page | Anti MX2 pAb (ATL-HPA030235) at Atlas Antibodies |
Documents & Links for Anti MX2 pAb (ATL-HPA030235) | |
Datasheet | Anti MX2 pAb (ATL-HPA030235) Datasheet (External Link) |
Vendor Page | Anti MX2 pAb (ATL-HPA030235) |
Citations for Anti MX2 pAb (ATL-HPA030235) – 3 Found |
Sali, Tina M; Pryke, Kara M; Abraham, Jinu; Liu, Andrew; Archer, Iris; Broeckel, Rebecca; Staverosky, Julia A; Smith, Jessica L; Al-Shammari, Ahmed; Amsler, Lisi; Sheridan, Kayla; Nilsen, Aaron; Streblow, Daniel N; DeFilippis, Victor R. Characterization of a Novel Human-Specific STING Agonist that Elicits Antiviral Activity Against Emerging Alphaviruses. Plos Pathogens. 2015;11(12):e1005324. PubMed |
Sandler, Netanya G; Bosinger, Steven E; Estes, Jacob D; Zhu, Richard T R; Tharp, Gregory K; Boritz, Eli; Levin, Doron; Wijeyesinghe, Sathi; Makamdop, Krystelle Nganou; del Prete, Gregory Q; Hill, Brenna J; Timmer, J Katherina; Reiss, Emma; Yarden, Ganit; Darko, Samuel; Contijoch, Eduardo; Todd, John Paul; Silvestri, Guido; Nason, Martha; Norgren, Robert B Jr; Keele, Brandon F; Rao, Srinivas; Langer, Jerome A; Lifson, Jeffrey D; Schreiber, Gideon; Douek, Daniel C. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature. 2014;511(7511):601-5. PubMed |
Deleage, Claire; Immonen, Taina T; Fennessey, Christine M; Reynaldi, Arnold; Reid, Carolyn; Newman, Laura; Lipkey, Leslie; Schlub, Timothy E; Camus, Celine; O'Brien, Sean; Smedley, Jeremy; Conway, Jessica M; Del Prete, Gregory Q; Davenport, Miles P; Lifson, Jeffrey D; Estes, Jacob D; Keele, Brandon F. Defining early SIV replication and dissemination dynamics following vaginal transmission. Science Advances. 2019;5(5):eaav7116. PubMed |