Anti MVB12A pAb (ATL-HPA041885)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041885-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MVB12A
Alternative Gene Name: FAM125A, FLJ32495
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031813: 77%, ENSRNOG00000017949: 73%
Entrez Gene ID: 93343
Uniprot ID: Q96EY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL |
Gene Sequence | LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL |
Gene ID - Mouse | ENSMUSG00000031813 |
Gene ID - Rat | ENSRNOG00000017949 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MVB12A pAb (ATL-HPA041885) | |
Datasheet | Anti MVB12A pAb (ATL-HPA041885) Datasheet (External Link) |
Vendor Page | Anti MVB12A pAb (ATL-HPA041885) at Atlas Antibodies |
Documents & Links for Anti MVB12A pAb (ATL-HPA041885) | |
Datasheet | Anti MVB12A pAb (ATL-HPA041885) Datasheet (External Link) |
Vendor Page | Anti MVB12A pAb (ATL-HPA041885) |