Anti MVB12A pAb (ATL-HPA041885)

Atlas Antibodies

Catalog No.: ATL-HPA041885-25

Protein Description: multivesicular body subunit 12A
Gene Name: MVB12A
Alternative Gene Name: FAM125A, FLJ32495
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031813: 77%, ENSRNOG00000017949: 73%
Entrez Gene ID: 93343
Uniprot ID: Q96EY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL
• Gene Sequence: LGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTL
• Gene ID - Mouse: ENSMUSG00000031813
• Gene ID - Rat: ENSRNOG00000017949
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.