Anti MGAT3 pAb (ATL-HPA017598)

Atlas Antibodies

Catalog No.:
ATL-HPA017598-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
Gene Name: MGAT3
Alternative Gene Name: GNT-III
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042428: 99%, ENSRNOG00000017434: 99%
Entrez Gene ID: 4248
Uniprot ID: Q09327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYG
Gene Sequence RRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYG
Gene ID - Mouse ENSMUSG00000042428
Gene ID - Rat ENSRNOG00000017434
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MGAT3 pAb (ATL-HPA017598)
Datasheet Anti MGAT3 pAb (ATL-HPA017598) Datasheet (External Link)
Vendor Page Anti MGAT3 pAb (ATL-HPA017598) at Atlas Antibodies

Documents & Links for Anti MGAT3 pAb (ATL-HPA017598)
Datasheet Anti MGAT3 pAb (ATL-HPA017598) Datasheet (External Link)
Vendor Page Anti MGAT3 pAb (ATL-HPA017598)