Anti MAN1A2 pAb (ATL-HPA034559 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034559-25

Protein Description: mannosidase, alpha, class 1A, member 2
Gene Name: MAN1A2
Alternative Gene Name: MAN1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008763: 73%, ENSRNOG00000015226: 75%
Entrez Gene ID: 10905
Uniprot ID: O60476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
• Gene Sequence: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
• Gene ID - Mouse: ENSMUSG00000008763
• Gene ID - Rat: ENSRNOG00000015226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.