Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037766-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 23
Gene Name: LRRC23
Alternative Gene Name: B7, LRPB7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030125: 85%, ENSRNOG00000047890: 86%
Entrez Gene ID: 10233
Uniprot ID: Q53EV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTDETSYR
Gene Sequence QNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTDETSYR
Gene ID - Mouse ENSMUSG00000030125
Gene ID - Rat ENSRNOG00000047890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation)
Datasheet Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation)
Datasheet Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC23 pAb (ATL-HPA037766 w/enhanced validation)