Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA004802-25
  • Immunohistochemical staining of human caudate nucleus shows moderate positivity in synapses and neuronal projections.
  • Western blot analysis in human cerebral cortex tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: lysosomal-associated membrane protein family, member 5
Gene Name: LAMP5
Alternative Gene Name: BAD-LAMP, C20orf103, dJ1119D9.3, UNC-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027270: 83%, ENSRNOG00000005457: 93%
Entrez Gene ID: 24141
Uniprot ID: Q9UJQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Gene Sequence FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Gene ID - Mouse ENSMUSG00000027270
Gene ID - Rat ENSRNOG00000005457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation)
Datasheet Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation)
Datasheet Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LAMP5 pAb (ATL-HPA004802 w/enhanced validation)