Anti KRT75 pAb (ATL-HPA019367)

Atlas Antibodies

Catalog No.:
ATL-HPA019367-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: keratin 75
Gene Name: KRT75
Alternative Gene Name: K6HF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022986: 81%, ENSRNOG00000043203: 79%
Entrez Gene ID: 9119
Uniprot ID: O95678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA
Gene Sequence MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA
Gene ID - Mouse ENSMUSG00000022986
Gene ID - Rat ENSRNOG00000043203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT75 pAb (ATL-HPA019367)
Datasheet Anti KRT75 pAb (ATL-HPA019367) Datasheet (External Link)
Vendor Page Anti KRT75 pAb (ATL-HPA019367) at Atlas Antibodies

Documents & Links for Anti KRT75 pAb (ATL-HPA019367)
Datasheet Anti KRT75 pAb (ATL-HPA019367) Datasheet (External Link)
Vendor Page Anti KRT75 pAb (ATL-HPA019367)