Anti KLF7 pAb (ATL-HPA030490)

Atlas Antibodies

Catalog No.:
ATL-HPA030490-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Kruppel-like factor 7 (ubiquitous)
Gene Name: KLF7
Alternative Gene Name: UKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025959: 95%, ENSRNOG00000012961: 95%
Entrez Gene ID: 8609
Uniprot ID: O75840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGG
Gene Sequence EAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGG
Gene ID - Mouse ENSMUSG00000025959
Gene ID - Rat ENSRNOG00000012961
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLF7 pAb (ATL-HPA030490)
Datasheet Anti KLF7 pAb (ATL-HPA030490) Datasheet (External Link)
Vendor Page Anti KLF7 pAb (ATL-HPA030490) at Atlas Antibodies

Documents & Links for Anti KLF7 pAb (ATL-HPA030490)
Datasheet Anti KLF7 pAb (ATL-HPA030490) Datasheet (External Link)
Vendor Page Anti KLF7 pAb (ATL-HPA030490)