Anti KCNK6 pAb (ATL-HPA040184)

Atlas Antibodies

Catalog No.: ATL-HPA040184-25

Protein Description: potassium channel, subfamily K, member 6
Gene Name: KCNK6
Alternative Gene Name: K2p6.1, TWIK-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046410: 68%, ENSRNOG00000020598: 68%
Entrez Gene ID: 9424
Uniprot ID: Q9Y257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
• Gene Sequence: LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
• Gene ID - Mouse: ENSMUSG00000046410
• Gene ID - Rat: ENSRNOG00000020598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNK6 pAb (ATL-HPA040184) – 1 Found

Kim, Sung Huhn; Kim, Bo Gyung; Kim, Jin Young; Roh, Kyung Jin; Suh, Michelle J; Jung, JinSei; Moon, In Seok; Moon, Sung K; Choi, Jae Young. Electrogenic transport and K(+) ion channel expression by the human endolymphatic sac epithelium. Scientific Reports. 2015;5( 26655723):18110.