Anti IKBKAP pAb (ATL-HPA050686)

Atlas Antibodies

Catalog No.:
ATL-HPA050686-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Gene Name: IKBKAP
Alternative Gene Name: DYS, ELP1, IKAP, IKI3, TOT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028431: 80%, ENSRNOG00000016725: 77%
Entrez Gene ID: 8518
Uniprot ID: O95163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG
Gene Sequence RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG
Gene ID - Mouse ENSMUSG00000028431
Gene ID - Rat ENSRNOG00000016725
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IKBKAP pAb (ATL-HPA050686)
Datasheet Anti IKBKAP pAb (ATL-HPA050686) Datasheet (External Link)
Vendor Page Anti IKBKAP pAb (ATL-HPA050686) at Atlas Antibodies

Documents & Links for Anti IKBKAP pAb (ATL-HPA050686)
Datasheet Anti IKBKAP pAb (ATL-HPA050686) Datasheet (External Link)
Vendor Page Anti IKBKAP pAb (ATL-HPA050686)