Anti IGFBP7 pAb (ATL-HPA002196)

Atlas Antibodies

Catalog No.: ATL-HPA002196-25

Protein Description: insulin-like growth factor binding protein 7
Gene Name: IGFBP7
Alternative Gene Name: FSTL2, IGFBP-7, MAC25, PSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036256: 95%, ENSRNOG00000002050: 94%
Entrez Gene ID: 3490
Uniprot ID: Q16270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA
• Gene Sequence: EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA
• Gene ID - Mouse: ENSMUSG00000036256
• Gene ID - Rat: ENSRNOG00000002050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IGFBP7 pAb (ATL-HPA002196) – 5 Found

Chugh, Shaan; Ouzounian, Maral; Lu, Zhen; Mohamed, Shanas; Li, Wenping; Bousette, Nicolas; Liu, Peter P; Gramolini, Anthony O. Pilot study identifying myosin heavy chain 7, desmin, insulin-like growth factor 7, and annexin A2 as circulating biomarkers of human heart failure. Proteomics. 2013;13(15):2324-34. 

Gambaro, Karen; Quinn, Michael C J; Cáceres-Gorriti, Katia Y; Shapiro, Rebecca S; Provencher, Diane; Rahimi, Kurosh; Mes-Masson, Anne-Marie; Tonin, Patricia N. Low levels of IGFBP7 expression in high-grade serous ovarian carcinoma is associated with patient outcome. Bmc Cancer. 2015;15( 25886299):135. 

Wu, Shang-Gin; Chang, Tzu-Hua; Tsai, Meng-Feng; Liu, Yi-Nan; Hsu, Chia-Lang; Chang, Yih-Leong; Yu, Chong-Jen; Shih, Jin-Yuan. IGFBP7 Drives Resistance to Epidermal Growth Factor Receptor Tyrosine Kinase Inhibition in Lung Cancer. Cancers. 2019;11(1) 

Nie, Yingchao; Yu, Shiyan; Li, Qi; Nirala, Niraj K; Amcheslavsky, Alla; Edwards, Yvonne J K; Shum, Patrick W; Jiang, Zhong; Wang, Wei; Zhang, Biliang; Gao, Nan; Ip, Y Tony. Oncogenic Pathways and Loss of the Rab11 GTPase Synergize To Alter Metabolism in Drosophila. Genetics. 2019;212(4):1227-1239. 

Jackstadt, Rene; van Hooff, Sander R; Leach, Joshua D; Cortes-Lavaud, Xabier; Lohuis, Jeroen O; Ridgway, Rachel A; Wouters, Valérie M; Roper, Jatin; Kendall, Timothy J; Roxburgh, Campbell S; Horgan, Paul G; Nixon, Colin; Nourse, Craig; Gunzer, Matthias; Clark, William; Hedley, Ann; Yilmaz, Omer H; Rashid, Mamunur; Bailey, Peter; Biankin, Andrew V; Campbell, Andrew D; Adams, David J; Barry, Simon T; Steele, Colin W; Medema, Jan Paul; Sansom, Owen J. Epithelial NOTCH Signaling Rewires the Tumor Microenvironment of Colorectal Cancer to Drive Poor-Prognosis Subtypes and Metastasis. Cancer Cell. 2019;36(3):319-336.e7.