Anti IDI1 pAb (ATL-HPA039169)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039169-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: IDI1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058258: 63%, ENSRNOG00000016690: 56%
Entrez Gene ID: 3422
Uniprot ID: Q13907
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKN |
Gene Sequence | ADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKN |
Gene ID - Mouse | ENSMUSG00000058258 |
Gene ID - Rat | ENSRNOG00000016690 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IDI1 pAb (ATL-HPA039169) | |
Datasheet | Anti IDI1 pAb (ATL-HPA039169) Datasheet (External Link) |
Vendor Page | Anti IDI1 pAb (ATL-HPA039169) at Atlas Antibodies |
Documents & Links for Anti IDI1 pAb (ATL-HPA039169) | |
Datasheet | Anti IDI1 pAb (ATL-HPA039169) Datasheet (External Link) |
Vendor Page | Anti IDI1 pAb (ATL-HPA039169) |