Anti HTR2B pAb (ATL-HPA063658)

Atlas Antibodies

Catalog No.:
ATL-HPA063658-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Gene Name: HTR2B
Alternative Gene Name: 5-HT(2B), 5-HT2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026228: 86%, ENSRNOG00000017625: 84%
Entrez Gene ID: 3357
Uniprot ID: P41595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS
Gene Sequence RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS
Gene ID - Mouse ENSMUSG00000026228
Gene ID - Rat ENSRNOG00000017625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HTR2B pAb (ATL-HPA063658)
Datasheet Anti HTR2B pAb (ATL-HPA063658) Datasheet (External Link)
Vendor Page Anti HTR2B pAb (ATL-HPA063658) at Atlas Antibodies

Documents & Links for Anti HTR2B pAb (ATL-HPA063658)
Datasheet Anti HTR2B pAb (ATL-HPA063658) Datasheet (External Link)
Vendor Page Anti HTR2B pAb (ATL-HPA063658)