Anti HS6ST2 pAb (ATL-HPA034626)

Atlas Antibodies

Catalog No.:
ATL-HPA034626-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: heparan sulfate 6-O-sulfotransferase 2
Gene Name: HS6ST2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062184: 98%, ENSRNOG00000030880: 98%
Entrez Gene ID: 90161
Uniprot ID: Q96MM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQK
Gene Sequence CQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQK
Gene ID - Mouse ENSMUSG00000062184
Gene ID - Rat ENSRNOG00000030880
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HS6ST2 pAb (ATL-HPA034626)
Datasheet Anti HS6ST2 pAb (ATL-HPA034626) Datasheet (External Link)
Vendor Page Anti HS6ST2 pAb (ATL-HPA034626) at Atlas Antibodies

Documents & Links for Anti HS6ST2 pAb (ATL-HPA034626)
Datasheet Anti HS6ST2 pAb (ATL-HPA034626) Datasheet (External Link)
Vendor Page Anti HS6ST2 pAb (ATL-HPA034626)