Anti HPF1 pAb (ATL-HPA043467)

Atlas Antibodies

Catalog No.: ATL-HPA043467-25

Protein Description: histone PARylation factor 1
Gene Name: HPF1
Alternative Gene Name: C4orf27, FLJ20534
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038005: 92%, ENSRNOG00000011293: 91%
Entrez Gene ID: 54969
Uniprot ID: Q9NWY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA
• Gene Sequence: LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA
• Gene ID - Mouse: ENSMUSG00000038005
• Gene ID - Rat: ENSRNOG00000011293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HPF1 pAb (ATL-HPA043467) – 2 Found

Huang, Dan; Camacho, Cristel V; Setlem, Rohit; Ryu, Keun Woo; Parameswaran, Balaji; Gupta, Rana K; Kraus, W Lee. Functional Interplay between Histone H2B ADP-Ribosylation and Phosphorylation Controls Adipogenesis. Molecular Cell. 2020;79(6):934-949.e14. 

Mosler, Thorsten; Baymaz, H Irem; Gräf, Justus F; Mikicic, Ivan; Blattner, Georges; Bartlett, Edward; Ostermaier, Matthias; Piccinno, Rossana; Yang, Jiwen; Voigt, Andrea; Gatti, Marco; Pellegrino, Stefania; Altmeyer, Matthias; Luck, Katja; Ahel, Ivan; Roukos, Vassilis; Beli, Petra. PARP1 proximity proteomics reveals interaction partners at stressed replication forks. Nucleic Acids Research. 2022;50(20):11600-11618.