Anti HK1 pAb (ATL-HPA011956)

Atlas Antibodies

SKU: ATL-HPA011956-25

• 

Protein Description: hexokinase 1
Gene Name: HK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020080: 95%, ENSRNOG00000006116: 79%
Entrez Gene ID: 3098
Uniprot ID: P19367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGTGEELFDHIVQCIADFLDYMGLKGASLPLGFTFSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
• Gene Sequence: QGTGEELFDHIVQCIADFLDYMGLKGASLPLGFTFSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
• Gene ID - Mouse: ENSMUSG00000020080
• Gene ID - Rat: ENSRNOG00000006116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HK1 pAb (ATL-HPA011956) – 2 Found

Khan, Md Wasim; Ding, Xianzhong; Cotler, Scott J; Clarke, Michael; Layden, Brian T. Studies on the Tissue Localization of HKDC1, a Putative Novel Fifth Hexokinase, in Humans. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2018;66(5):385-392. 

Pusec, Carolina M; De Jesus, Adam; Khan, Md Wasim; Terry, Alexander R; Ludvik, Anton E; Xu, Kai; Giancola, Nicholas; Pervaiz, Haaris; Daviau Smith, Emily; Ding, Xianzhong; Harrison, Stephen; Chandel, Navdeep S; Becker, Thomas C; Hay, Nissim; Ardehali, Hossein; Cordoba-Chacon, Jose; Layden, Brian T. Hepatic HKDC1 Expression Contributes to Liver Metabolism. Endocrinology. 2019;160(2):313-330.