Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA052407-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: gasdermin B
Gene Name: GSDMB
Alternative Gene Name: GSDML, PRO2521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033053: 30%, ENSRNOG00000018929: 28%
Entrez Gene ID: 55876
Uniprot ID: Q8TAX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLV
Gene Sequence GKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLV
Gene ID - Mouse ENSMUSG00000033053
Gene ID - Rat ENSRNOG00000018929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation)
Datasheet Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation)
Datasheet Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation)
Citations for Anti GSDMB pAb (ATL-HPA052407 w/enhanced validation) – 1 Found
Huntington, Kelsey E; Louie, Anna D; Srinivasan, Praveen R; Schorl, Christoph; Lu, Shaolei; Silverberg, David; Newhouse, Daniel; Wu, Zhijin; Zhou, Lanlan; Borden, Brittany A; Giles, Francis J; Dooner, Mark; Carneiro, Benedito A; El-Deiry, Wafik S. GSK-3 inhibitor elraglusib enhances tumor-infiltrating immune cell activation in tumor biopsies and synergizes with anti-PD-L1 in a murine model of colorectal cancer. Biorxiv : The Preprint Server For Biology. 2023; 36798357( 36798357)  PubMed