Anti DONSON pAb (ATL-HPA039558)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039558-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: DONSON
Alternative Gene Name: B17, C21orf60, C2TA, DKFZP434M035
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022960: 90%, ENSRNOG00000002012: 88%
Entrez Gene ID: 29980
Uniprot ID: Q9NYP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDPKLSSELRCTFQQSLIYWLHPALSWLPLFPRIG |
| Gene Sequence | VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDPKLSSELRCTFQQSLIYWLHPALSWLPLFPRIG |
| Gene ID - Mouse | ENSMUSG00000022960 |
| Gene ID - Rat | ENSRNOG00000002012 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DONSON pAb (ATL-HPA039558) | |
| Datasheet | Anti DONSON pAb (ATL-HPA039558) Datasheet (External Link) |
| Vendor Page | Anti DONSON pAb (ATL-HPA039558) at Atlas Antibodies |
| Documents & Links for Anti DONSON pAb (ATL-HPA039558) | |
| Datasheet | Anti DONSON pAb (ATL-HPA039558) Datasheet (External Link) |
| Vendor Page | Anti DONSON pAb (ATL-HPA039558) |
| Citations for Anti DONSON pAb (ATL-HPA039558) – 2 Found |
| Klümper, Niklas; Blajan, Iulia; Schmidt, Doris; Kristiansen, Glen; Toma, Marieta; Hölzel, Michael; Ritter, Manuel; Ellinger, Jörg. Downstream neighbor of SON (DONSON) is associated with unfavorable survival across diverse cancers with oncogenic properties in clear cell renal cell carcinoma. Translational Oncology. 2020;13(11):100844. PubMed |
| Klümper, Niklas; von Danwitz, Marthe; Stein, Johannes; Schmidt, Doris; Schmidt, Anja; Kristiansen, Glen; Muders, Michael; Hölzel, Michael; Ritter, Manuel; Alajati, Abdullah; Ellinger, Jörg. Downstream Neighbor of SON (DONSON) Expression Is Enhanced in Phenotypically Aggressive Prostate Cancers. Cancers. 2020;12(11) PubMed |