Anti DONSON pAb (ATL-HPA039558)

Atlas Antibodies

Catalog No.: ATL-HPA039558-100

Protein Description: downstream neighbor of SON
Gene Name: DONSON
Alternative Gene Name: B17, C21orf60, C2TA, DKFZP434M035
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022960: 90%, ENSRNOG00000002012: 88%
Entrez Gene ID: 29980
Uniprot ID: Q9NYP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDPKLSSELRCTFQQSLIYWLHPALSWLPLFPRIG
• Gene Sequence: VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDPKLSSELRCTFQQSLIYWLHPALSWLPLFPRIG
• Gene ID - Mouse: ENSMUSG00000022960
• Gene ID - Rat: ENSRNOG00000002012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DONSON pAb (ATL-HPA039558) – 2 Found

Klümper, Niklas; Blajan, Iulia; Schmidt, Doris; Kristiansen, Glen; Toma, Marieta; Hölzel, Michael; Ritter, Manuel; Ellinger, Jörg. Downstream neighbor of SON (DONSON) is associated with unfavorable survival across diverse cancers with oncogenic properties in clear cell renal cell carcinoma. Translational Oncology. 2020;13(11):100844. 

Klümper, Niklas; von Danwitz, Marthe; Stein, Johannes; Schmidt, Doris; Schmidt, Anja; Kristiansen, Glen; Muders, Michael; Hölzel, Michael; Ritter, Manuel; Alajati, Abdullah; Ellinger, Jörg. Downstream Neighbor of SON (DONSON) Expression Is Enhanced in Phenotypically Aggressive Prostate Cancers. Cancers. 2020;12(11)