Anti COL9A3 pAb (ATL-HPA040125)

Atlas Antibodies

Catalog No.: ATL-HPA040125-25

Protein Description: collagen, type IX, alpha 3
Gene Name: COL9A3
Alternative Gene Name: DJ885L7.4.1, EDM3, FLJ90759, IDD, MED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027570: 98%, ENSRNOG00000009531: 98%
Entrez Gene ID: 1299
Uniprot ID: Q14050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP
• Gene Sequence: PGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP
• Gene ID - Mouse: ENSMUSG00000027570
• Gene ID - Rat: ENSRNOG00000009531
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.