Anti CNTN5 pAb (ATL-HPA041223)

Atlas Antibodies

SKU:
ATL-HPA041223-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in leydig cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: contactin 5
Gene Name: CNTN5
Alternative Gene Name: hNB-2, NB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039488: 85%, ENSRNOG00000007038: 86%
Entrez Gene ID: 53942
Uniprot ID: O94779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Gene Sequence IVVICSAEGEPSAAPTDVKATSVSVSEILVAWKHIKESLGRPQGFEVGYWKDMEQEDTAETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYG
Gene ID - Mouse ENSMUSG00000039488
Gene ID - Rat ENSRNOG00000007038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNTN5 pAb (ATL-HPA041223)
Datasheet Anti CNTN5 pAb (ATL-HPA041223) Datasheet (External Link)
Vendor Page Anti CNTN5 pAb (ATL-HPA041223) at Atlas Antibodies

Documents & Links for Anti CNTN5 pAb (ATL-HPA041223)
Datasheet Anti CNTN5 pAb (ATL-HPA041223) Datasheet (External Link)
Vendor Page Anti CNTN5 pAb (ATL-HPA041223)