Anti APOLD1 pAb (ATL-HPA052462)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052462-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: APOLD1
Alternative Gene Name: DKFZP434F0318, FLJ25138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090698: 85%, ENSRNOG00000007830: 87%
Entrez Gene ID: 81575
Uniprot ID: Q96LR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASI |
Gene Sequence | SLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASI |
Gene ID - Mouse | ENSMUSG00000090698 |
Gene ID - Rat | ENSRNOG00000007830 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOLD1 pAb (ATL-HPA052462) | |
Datasheet | Anti APOLD1 pAb (ATL-HPA052462) Datasheet (External Link) |
Vendor Page | Anti APOLD1 pAb (ATL-HPA052462) at Atlas Antibodies |
Documents & Links for Anti APOLD1 pAb (ATL-HPA052462) | |
Datasheet | Anti APOLD1 pAb (ATL-HPA052462) Datasheet (External Link) |
Vendor Page | Anti APOLD1 pAb (ATL-HPA052462) |