Anti APOLD1 pAb (ATL-HPA052462)

Atlas Antibodies

Catalog No.:
ATL-HPA052462-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: apolipoprotein L domain containing 1
Gene Name: APOLD1
Alternative Gene Name: DKFZP434F0318, FLJ25138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090698: 85%, ENSRNOG00000007830: 87%
Entrez Gene ID: 81575
Uniprot ID: Q96LR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASI
Gene Sequence SLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASI
Gene ID - Mouse ENSMUSG00000090698
Gene ID - Rat ENSRNOG00000007830
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOLD1 pAb (ATL-HPA052462)
Datasheet Anti APOLD1 pAb (ATL-HPA052462) Datasheet (External Link)
Vendor Page Anti APOLD1 pAb (ATL-HPA052462) at Atlas Antibodies

Documents & Links for Anti APOLD1 pAb (ATL-HPA052462)
Datasheet Anti APOLD1 pAb (ATL-HPA052462) Datasheet (External Link)
Vendor Page Anti APOLD1 pAb (ATL-HPA052462)