Anti ZNF691 pAb (ATL-HPA062527)

Atlas Antibodies

Catalog No.: ATL-HPA062527-25

Protein Description: zinc finger protein 691
Gene Name: ZNF691
Alternative Gene Name: Zfp691
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045268: 52%, ENSRNOG00000007398: 58%
Entrez Gene ID: 51058
Uniprot ID: Q5VV52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPWQKVTVRARELGDPIAHPRHEADEKPFICAQ
• Gene Sequence: KPWQKVTVRARELGDPIAHPRHEADEKPFICAQ
• Gene ID - Mouse: ENSMUSG00000045268
• Gene ID - Rat: ENSRNOG00000007398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.