Anti ZNF513 pAb (ATL-HPA051493)

Atlas Antibodies

Catalog No.: ATL-HPA051493-25

Protein Description: zinc finger protein 513
Gene Name: ZNF513
Alternative Gene Name: FLJ32203, RP58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043059: 96%, ENSRNOG00000005298: 96%
Entrez Gene ID: 130557
Uniprot ID: Q8N8E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMK
• Gene Sequence: LPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMK
• Gene ID - Mouse: ENSMUSG00000043059
• Gene ID - Rat: ENSRNOG00000005298
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.