Anti ZNF513 pAb (ATL-HPA051493)

Atlas Antibodies

SKU:
ATL-HPA051493-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 513
Gene Name: ZNF513
Alternative Gene Name: FLJ32203, RP58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043059: 96%, ENSRNOG00000005298: 96%
Entrez Gene ID: 130557
Uniprot ID: Q8N8E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMK
Gene Sequence LPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMK
Gene ID - Mouse ENSMUSG00000043059
Gene ID - Rat ENSRNOG00000005298
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF513 pAb (ATL-HPA051493)
Datasheet Anti ZNF513 pAb (ATL-HPA051493) Datasheet (External Link)
Vendor Page Anti ZNF513 pAb (ATL-HPA051493) at Atlas Antibodies

Documents & Links for Anti ZNF513 pAb (ATL-HPA051493)
Datasheet Anti ZNF513 pAb (ATL-HPA051493) Datasheet (External Link)
Vendor Page Anti ZNF513 pAb (ATL-HPA051493)