Anti ZNF436 pAb (ATL-HPA043817 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043817-100

Protein Description: zinc finger protein 436
Gene Name: ZNF436
Alternative Gene Name: KIAA1710, Zfp46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051351: 78%, ENSRNOG00000049975: 62%
Entrez Gene ID: 80818
Uniprot ID: Q9C0F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVH
• Gene Sequence: SENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVH
• Gene ID - Mouse: ENSMUSG00000051351
• Gene ID - Rat: ENSRNOG00000049975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.