Anti ZNF16 pAb (ATL-HPA061835)

Atlas Antibodies

SKU:
ATL-HPA061835-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 16
Gene Name: ZNF16
Alternative Gene Name: KOX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068962: 36%, ENSRNOG00000032625: 36%
Entrez Gene ID: 7564
Uniprot ID: P17020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGLLRGPLGEKDLDCNGFDSRFSLSPNLMACQEIPTEERPHPYDMGGQSFQHSVDLTGHEGVPTAESPL
Gene Sequence MGLLRGPLGEKDLDCNGFDSRFSLSPNLMACQEIPTEERPHPYDMGGQSFQHSVDLTGHEGVPTAESPL
Gene ID - Mouse ENSMUSG00000068962
Gene ID - Rat ENSRNOG00000032625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF16 pAb (ATL-HPA061835)
Datasheet Anti ZNF16 pAb (ATL-HPA061835) Datasheet (External Link)
Vendor Page Anti ZNF16 pAb (ATL-HPA061835) at Atlas Antibodies

Documents & Links for Anti ZNF16 pAb (ATL-HPA061835)
Datasheet Anti ZNF16 pAb (ATL-HPA061835) Datasheet (External Link)
Vendor Page Anti ZNF16 pAb (ATL-HPA061835)