Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041327-25
  • Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ZC3H18 antibody HPA041327 (A) shows similar protein distribution across tissues to independent antibody HPA040847 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger CCCH-type containing 18
Gene Name: ZC3H18
Alternative Gene Name: NHN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017478: 96%, ENSRNOG00000028501: 96%
Entrez Gene ID: 124245
Uniprot ID: Q86VM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
Gene Sequence QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
Gene ID - Mouse ENSMUSG00000017478
Gene ID - Rat ENSRNOG00000028501
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation)
Datasheet Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation)