Anti ZBTB21 pAb (ATL-HPA024655 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024655-25

• 
• 
• 

Protein Description: zinc finger and BTB domain containing 21
Gene Name: ZBTB21
Alternative Gene Name: KIAA1227, ZNF295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046962: 86%, ENSRNOG00000001623: 86%
Entrez Gene ID: 49854
Uniprot ID: Q9ULJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPEPNKVNHIVTTKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEAGPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQASEESAHKESEVCP
• Gene Sequence: QPEPNKVNHIVTTKDDNVFSDSSEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEAGPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQASEESAHKESEVCP
• Gene ID - Mouse: ENSMUSG00000046962
• Gene ID - Rat: ENSRNOG00000001623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.