Anti UBE3B pAb (ATL-HPA041012)

Atlas Antibodies

SKU: ATL-HPA041012-25

• 
• 

Protein Description: ubiquitin protein ligase E3B
Gene Name: UBE3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029577: 87%, ENSRNOG00000047219: 85%
Entrez Gene ID: 89910
Uniprot ID: Q7Z3V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV
• Gene Sequence: ANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPVIAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV
• Gene ID - Mouse: ENSMUSG00000029577
• Gene ID - Rat: ENSRNOG00000047219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBE3B pAb (ATL-HPA041012) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.