Anti TRIM9 pAb (ATL-HPA041489)
Atlas Antibodies
- SKU:
- ATL-HPA041489-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TRIM9
Alternative Gene Name: RNF91, SPRING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021071: 100%, ENSRNOG00000007031: 100%
Entrez Gene ID: 114088
Uniprot ID: Q9C026
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD |
Gene Sequence | QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD |
Gene ID - Mouse | ENSMUSG00000021071 |
Gene ID - Rat | ENSRNOG00000007031 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIM9 pAb (ATL-HPA041489) | |
Datasheet | Anti TRIM9 pAb (ATL-HPA041489) Datasheet (External Link) |
Vendor Page | Anti TRIM9 pAb (ATL-HPA041489) at Atlas Antibodies |
Documents & Links for Anti TRIM9 pAb (ATL-HPA041489) | |
Datasheet | Anti TRIM9 pAb (ATL-HPA041489) Datasheet (External Link) |
Vendor Page | Anti TRIM9 pAb (ATL-HPA041489) |