Anti TPD52 pAb (ATL-HPA028427 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028427-25

• 

Protein Description: tumor protein D52
Gene Name: TPD52
Alternative Gene Name: D52, hD52, N8L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027506: 76%, ENSRNOG00000011441: 78%
Entrez Gene ID: 7163
Uniprot ID: P55327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTL
• Gene Sequence: MDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTL
• Gene ID - Mouse: ENSMUSG00000027506
• Gene ID - Rat: ENSRNOG00000011441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TPD52 pAb (ATL-HPA028427 w/enhanced validation) – 1 Found

Kumamoto, Tomohiro; Seki, Naohiko; Mataki, Hiroko; Mizuno, Keiko; Kamikawaji, Kazuto; Samukawa, Takuya; Koshizuka, Keiichi; Goto, Yusuke; Inoue, Hiromasa. Regulation of TPD52 by antitumor microRNA-218 suppresses cancer cell migration and invasion in lung squamous cell carcinoma. International Journal Of Oncology. 2016;49(5):1870-1880.