Anti TESPA1 pAb (ATL-HPA058823)

Atlas Antibodies

SKU:
ATL-HPA058823-25
  • Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: thymocyte expressed, positive selection associated 1
Gene Name: TESPA1
Alternative Gene Name: KIAA0748
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037855: 25%, ENSRNOG00000025889: 26%
Entrez Gene ID: 9840
Uniprot ID: A2RU30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNTETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQT
Gene Sequence TNTETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQT
Gene ID - Mouse ENSMUSG00000037855
Gene ID - Rat ENSRNOG00000025889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TESPA1 pAb (ATL-HPA058823)
Datasheet Anti TESPA1 pAb (ATL-HPA058823) Datasheet (External Link)
Vendor Page Anti TESPA1 pAb (ATL-HPA058823) at Atlas Antibodies

Documents & Links for Anti TESPA1 pAb (ATL-HPA058823)
Datasheet Anti TESPA1 pAb (ATL-HPA058823) Datasheet (External Link)
Vendor Page Anti TESPA1 pAb (ATL-HPA058823)