Anti TESK2 pAb (ATL-HPA063869)

Atlas Antibodies

Catalog No.:
ATL-HPA063869-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: testis-specific kinase 2
Gene Name: TESK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033985: 83%, ENSRNOG00000017282: 89%
Entrez Gene ID: 10420
Uniprot ID: Q96S53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPF
Gene Sequence FDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPF
Gene ID - Mouse ENSMUSG00000033985
Gene ID - Rat ENSRNOG00000017282
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TESK2 pAb (ATL-HPA063869)
Datasheet Anti TESK2 pAb (ATL-HPA063869) Datasheet (External Link)
Vendor Page Anti TESK2 pAb (ATL-HPA063869) at Atlas Antibodies

Documents & Links for Anti TESK2 pAb (ATL-HPA063869)
Datasheet Anti TESK2 pAb (ATL-HPA063869) Datasheet (External Link)
Vendor Page Anti TESK2 pAb (ATL-HPA063869)