Anti SMAD6 pAb (ATL-HPA061917)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061917-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SMAD6
Alternative Gene Name: HsT17432, MADH6, MADH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036867: 90%, ENSRNOG00000009173: 90%
Entrez Gene ID: 4091
Uniprot ID: O43541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF |
Gene Sequence | PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF |
Gene ID - Mouse | ENSMUSG00000036867 |
Gene ID - Rat | ENSRNOG00000009173 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SMAD6 pAb (ATL-HPA061917) | |
Datasheet | Anti SMAD6 pAb (ATL-HPA061917) Datasheet (External Link) |
Vendor Page | Anti SMAD6 pAb (ATL-HPA061917) at Atlas Antibodies |
Documents & Links for Anti SMAD6 pAb (ATL-HPA061917) | |
Datasheet | Anti SMAD6 pAb (ATL-HPA061917) Datasheet (External Link) |
Vendor Page | Anti SMAD6 pAb (ATL-HPA061917) |