Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA074835-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SLIT and NTRK like family member 1
Gene Name: SLITRK1
Alternative Gene Name: KIAA1910, LRRC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075478: 99%, ENSRNOG00000009209: 99%
Entrez Gene ID: 114798
Uniprot ID: Q96PX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSIS
Gene Sequence ECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSIS
Gene ID - Mouse ENSMUSG00000075478
Gene ID - Rat ENSRNOG00000009209
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation)
Datasheet Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation)