Anti SLC4A5 pAb (ATL-HPA036621)

Atlas Antibodies

Catalog No.: ATL-HPA036621-25

Protein Description: solute carrier family 4 (sodium bicarbonate cotransporter), member 5
Gene Name: SLC4A5
Alternative Gene Name: NBC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068323: 77%, ENSRNOG00000010378: 76%
Entrez Gene ID: 57835
Uniprot ID: Q9BY07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
• Gene Sequence: SQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
• Gene ID - Mouse: ENSMUSG00000068323
• Gene ID - Rat: ENSRNOG00000010378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC4A5 pAb (ATL-HPA036621) – 3 Found

Collin, Gayle B; Shi, Lanying; Yu, Minzhong; Akturk, Nurten; Charette, Jeremy R; Hyde, Lillian F; Weatherly, Sonia M; Pera, Martin F; Naggert, Jürgen K; Peachey, Neal S; Nishina, Patsy M; Krebs, Mark P. A Splicing Mutation in Slc4a5 Results in Retinal Detachment and Retinal Pigment Epithelium Dysfunction. International Journal Of Molecular Sciences. 2022;23(4) 

Gildea, John J; Xu, Peng; Carlson, Julia M; Gaglione, Robert T; Bigler Wang, Dora; Kemp, Brandon A; Reyes, Camellia M; McGrath, Helen E; Carey, Robert M; Jose, Pedro A; Felder, Robin A. The sodium-bicarbonate cotransporter NBCe2 (slc4a5) expressed in human renal proximal tubules shows increased apical expression under high-salt conditions. American Journal Of Physiology. Regulatory, Integrative And Comparative Physiology. 2015;309(11):R1447-59. 

Gildea, John J; Xu, Peng; Kemp, Brandon A; Carlson, Julia M; Tran, Hanh T; Bigler Wang, Dora; Langouët-Astrié, Christophe J; McGrath, Helen E; Carey, Robert M; Jose, Pedro A; Felder, Robin A. Sodium bicarbonate cotransporter NBCe2 gene variants increase sodium and bicarbonate transport in human renal proximal tubule cells. Plos One. 13(4):e0189464.