Anti SLC35C2 pAb (ATL-HPA027011)

Atlas Antibodies

Catalog No.:
ATL-HPA027011-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35 (GDP-fucose transporter), member C2
Gene Name: SLC35C2
Alternative Gene Name: bA394O2.1, C20orf5, CGI-15, OVCOV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017664: 83%, ENSRNOG00000018649: 80%
Entrez Gene ID: 51006
Uniprot ID: Q9NQQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
Gene Sequence KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
Gene ID - Mouse ENSMUSG00000017664
Gene ID - Rat ENSRNOG00000018649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35C2 pAb (ATL-HPA027011)
Datasheet Anti SLC35C2 pAb (ATL-HPA027011) Datasheet (External Link)
Vendor Page Anti SLC35C2 pAb (ATL-HPA027011) at Atlas Antibodies

Documents & Links for Anti SLC35C2 pAb (ATL-HPA027011)
Datasheet Anti SLC35C2 pAb (ATL-HPA027011) Datasheet (External Link)
Vendor Page Anti SLC35C2 pAb (ATL-HPA027011)