Anti SLC2A13 pAb (ATL-HPA061679 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061679-25

• 
• 

Protein Description: solute carrier family 2 member 13
Gene Name: SLC2A13
Alternative Gene Name: HMIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036298: 90%, ENSRNOG00000015741: 90%
Entrez Gene ID: 114134
Uniprot ID: Q96QE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYP
• Gene Sequence: PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYP
• Gene ID - Mouse: ENSMUSG00000036298
• Gene ID - Rat: ENSRNOG00000015741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.