Anti SLC25A15 pAb (ATL-HPA042146)
Atlas Antibodies
- SKU:
- ATL-HPA042146-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC25A15
Alternative Gene Name: D13S327, HHH, ORC1, ORNT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031482: 93%, ENSRNOG00000011881: 93%
Entrez Gene ID: 10166
Uniprot ID: Q9Y619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GTACVLTGQPFDTIKVKMQTFPDLYKGLTD |
Gene Sequence | GTACVLTGQPFDTIKVKMQTFPDLYKGLTD |
Gene ID - Mouse | ENSMUSG00000031482 |
Gene ID - Rat | ENSRNOG00000011881 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC25A15 pAb (ATL-HPA042146) | |
Datasheet | Anti SLC25A15 pAb (ATL-HPA042146) Datasheet (External Link) |
Vendor Page | Anti SLC25A15 pAb (ATL-HPA042146) at Atlas Antibodies |
Documents & Links for Anti SLC25A15 pAb (ATL-HPA042146) | |
Datasheet | Anti SLC25A15 pAb (ATL-HPA042146) Datasheet (External Link) |
Vendor Page | Anti SLC25A15 pAb (ATL-HPA042146) |